HMGB1 Monoclonal antibody, PBS Only

HMGB1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66525-1-PBS
Clone No.1D12A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Indirect ELISA

HMG1, HMG 1, High mobility group protein B1, High mobility group protein 1, high mobility group box 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66525-1-PBS targets HMGB1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1264

Product name: Recombinant human HMGB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-215 aa of BC003378

Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Predict reactive species
Full Name high-mobility group box 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC003378
Gene Symbol HMGB1
Gene ID (NCBI) 3146
RRIDAB_2881888
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP09429
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The HMG (high mobility group) proteins are nonhistone chromosomal proteins that is present in almost all eukaryotic cells, and it functions to stabilize NUCLEOSOME formation and acts as a transcription-factor-like protein that regulates the expression of several genes[PMID: 18160415]. Once injury, infection or other inflammatory stimuli, activated macrophages, mature dendritic cells and natural killer cells can secret HMGB1, which act as a crucial cytokine[PMID: 20163887]. HMGB1 also involved in V(D)J recombination by acting as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS)[PMID: 19360789 ]. Act as a Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. HMGB1 (high mobility group box 1) modulates gene expression in the nucleus, but certain immune cells secrete HMGB1 as an extracellular Alarmin to signal tissue damage.The nuclear HMGB1 relocalizes to the extracellular milieu in senescent human and mouse cells in culture and in vivo, which stimulated cytokine secretion through TLR-4 signaling (23649808).This antibody is raised against full length HMGB1 of human origin. The monomeric HMGB1 is 29 kDa and dimer is 58 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...