Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse brain tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Positive ChIP-qPCR detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
81984-2-RR targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species |
| Full Name | histone cluster 2, H3a |
| Calculated Molecular Weight | 136 aa, 15 kDa |
| Observed Molecular Weight | 15-17 kDa |
| GenBank Accession Number | BC015544 |
| Gene Symbol | Histone H3 |
| Gene ID (NCBI) | 333932 |
| RRID | AB_3670510 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q71DI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| IHC protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| WB protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













