Histone H3 Recombinant monoclonal antibody, PBS Only

Histone H3 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR
Cat No. 81984-2-PBS
Clone No.241079B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

HIST2H3A, 241079B2, H3C13, H3C14, H3C15

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

81984-2-PBS targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10644

Product name: Recombinant human Histone-H3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-136 aa of BC015544

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predict reactive species
Full Name histone cluster 2, H3a
Calculated Molecular Weight 136 aa, 15 kDa
Observed Molecular Weight15-17 kDa
GenBank Accession NumberBC015544
Gene Symbol Histone H3
Gene ID (NCBI) 333932
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ71DI3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.

Protocols

Product Specific Protocols
FC protocol for Histone H3 antibody 81984-2-PBSDownload protocol
IHC protocol for Histone H3 antibody 81984-2-PBSDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...