• Featured Product
  • KD/KO Validated

Integrin alpha-5/CD49e Polyclonal antibody

Integrin alpha-5/CD49e Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10569-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey and More (1)

Applications

WB, IHC, IF, ELISA

Integrin Alpha-5, ITGA5, CD49 antigen-like family member E, CD49e, FNRA

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, 3T3-L1 cells, COS-7 cells, HeLa cells, human placenta tissue
Positive IHC detected inhuman placenta tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10569-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, monkey samples.

Tested Reactivity human, mouse, monkey
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0860

Product name: Recombinant human Integrin alpha-5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 749-1049 aa of BC008786

Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Predict reactive species
Full Name integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Calculated Molecular Weight 115 kDa
Observed Molecular Weight 135-150 kDa
GenBank Accession NumberBC008786
Gene Symbol Integrin alpha 5
Gene ID (NCBI) 3678
RRIDAB_2130060
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08648
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483).

Protocols

Product Specific Protocols
WB protocol for Integrin alpha-5/CD49e antibody 10569-1-APDownload protocol
IHC protocol for Integrin alpha-5/CD49e antibody 10569-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Biomaterials

Osteogenesis potential of different titania nanotubes in oxidative stress microenvironment.

Authors - Yonglin Yu
mouseWB

Int J Mol Sci

Atp6v1h Deficiency Blocks Bone Loss in Simulated Microgravity Mice through the Fos-Jun-Src-Integrin Pathway

Authors - Zanyan Zhao
humanWB,IF

Front Cell Dev Biol

Mesenchymal Stem Cells With Cancer-Associated Fibroblast-Like Phenotype Stimulate SDF-1/CXCR4 Axis to Enhance the Growth and Invasion of B-Cell Acute Lymphoblastic Leukemia Cells Through Cell-to-Cell Communication.

Authors - Chengyun Pan
humanWB

Oncotarget

Annexin A4 fucosylation enhances its interaction with the NF-kB p50 and promotes tumor progression of ovarian clear cell carcinoma.

Authors - Huimin Wang

Sci Rep

Evidence of novel miR-34a-based therapeutic approaches for multiple myeloma treatment.

Authors - Mayra Rachele Zarone
humanIF

Front Oncol

ITGA5 Is a Novel Oncogenic Biomarker and Correlates With Tumor Immune Microenvironment in Gliomas.

Authors - Shuyu Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (02-04-2019)

Excellent. In WB, it gives a protein band at the expected molecular weight, and this band was decreased during adipocyte differentiation, which is consistent with those reported in literature. In IF, it labels endogenous protein at the cell surface, as that reported in literature.

  • Applications: Western Blot, Immunofluorescence,
Loading...