JIP1/IB-1 Polyclonal antibody

JIP1/IB-1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14568-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

MAPK8IP1, Islet-brain 1, Islet brain 1, IB-1, IB1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue
Positive IP detected inmouse brain tissue, rat brain tissue
Positive IHC detected inhuman oesophagus cancer tissue, mouse brain tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14568-1-AP targets JIP1/IB-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6150

Product name: Recombinant human JIP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 366-711 aa of BC068470

Sequence: SLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEINVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADNRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE

Predict reactive species
Full Name mitogen-activated protein kinase 8 interacting protein 1
Calculated Molecular Weight 78 kDa
Observed Molecular Weight 97-116 kDa
GenBank Accession NumberBC068470
Gene Symbol MAPK8IP1/IB-1
Gene ID (NCBI) 9479
RRIDAB_2281682
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UQF2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for JIP1/IB-1 antibody 14568-1-APDownload protocol
IHC protocol for JIP1/IB-1 antibody 14568-1-APDownload protocol
IP protocol for JIP1/IB-1 antibody 14568-1-APDownload protocol
WB protocol for JIP1/IB-1 antibody 14568-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Curr Biol

Stretch triggers microtubule stabilization and MARCKS-dependent membrane incorporation in the shaft of embryonic axons

Authors - Sara C Sousa
mouseIF

ACS Chem Neurosci

Antidepressant-like Effect of Merazin Hydrate Depends on NO/ERK by Suppressing Its Downstream NF-κB or Nonactivating CREB/BDNF in Mouse Hippocampus.

Authors - Lei Wu
humanIP, WB

Front Physiol

Ras-Related C3 Botulinum Toxin Substrate 1 Combining With the Mixed Lineage Kinase 3- Mitogen-Activated Protein Kinase 7- c-Jun N-Terminal Kinase Signaling Module Accelerates Diabetic Nephropathy.

Authors - Changjiang Ying
mouseWB

Saudi Pharm J

iTRAQ-derived quantitative proteomics uncovers the neuroprotective property of bexarotene in a mice model of cerebral ischemia-reperfusion injury.

Authors - Hailin Liu
mouseWB

Cell Rep

SFRS11 Loss Leads to Aging-Associated Cognitive Decline by Modulating LRP8 and ApoE.

Authors - Obayed Raihan
humanWB

Oncotarget

Autophagy-related gene expression is an independent prognostic indicator of glioma.

Authors - Huixue Zhang
Loading...
||
New chat Able
正在加载,请稍候...