Tested Applications
| Positive WB detected in | fetal human brain tissue |
| Positive IP detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human oesophagus cancer tissue, mouse brain tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
14568-1-AP targets JIP1/IB-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6150 Product name: Recombinant human JIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 366-711 aa of BC068470 Sequence: SLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEINVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADNRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE Predict reactive species |
| Full Name | mitogen-activated protein kinase 8 interacting protein 1 |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 97-116 kDa |
| GenBank Accession Number | BC068470 |
| Gene Symbol | MAPK8IP1/IB-1 |
| Gene ID (NCBI) | 9479 |
| RRID | AB_2281682 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQF2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for JIP1/IB-1 antibody 14568-1-AP | Download protocol |
| IHC protocol for JIP1/IB-1 antibody 14568-1-AP | Download protocol |
| IP protocol for JIP1/IB-1 antibody 14568-1-AP | Download protocol |
| WB protocol for JIP1/IB-1 antibody 14568-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Curr Biol Stretch triggers microtubule stabilization and MARCKS-dependent membrane incorporation in the shaft of embryonic axons | ||
ACS Chem Neurosci Antidepressant-like Effect of Merazin Hydrate Depends on NO/ERK by Suppressing Its Downstream NF-κB or Nonactivating CREB/BDNF in Mouse Hippocampus. | ||
Front Physiol Ras-Related C3 Botulinum Toxin Substrate 1 Combining With the Mixed Lineage Kinase 3- Mitogen-Activated Protein Kinase 7- c-Jun N-Terminal Kinase Signaling Module Accelerates Diabetic Nephropathy. | ||
Saudi Pharm J iTRAQ-derived quantitative proteomics uncovers the neuroprotective property of bexarotene in a mice model of cerebral ischemia-reperfusion injury. | ||
Cell Rep SFRS11 Loss Leads to Aging-Associated Cognitive Decline by Modulating LRP8 and ApoE. | ||
Oncotarget Autophagy-related gene expression is an independent prognostic indicator of glioma. |























