KRT7 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag17528

Synonyms

CK7; K2C7; K7; MGC129731; MGC3625; SCL



Product Information

Peptide Sequence MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ
(1-94 aa encoded by BC002700)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.