Tested Applications
| Positive WB detected in | T-47D cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, K-562 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
66569-1-Ig targets LATS1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species |
| Full Name | LATS, large tumor suppressor, homolog 1 (Drosophila) |
| Calculated Molecular Weight | 15 kDa, 127 kDa |
| Observed Molecular Weight | 140-150 kDa, 120 kDa |
| GenBank Accession Number | BC015665 |
| Gene Symbol | LATS1 |
| Gene ID (NCBI) | 9113 |
| RRID | AB_2881930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O95835 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongds to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LATS1 antibody 66569-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer Co-transcriptional R-loops-mediated epigenetic regulation drives growth retardation and docetaxel chemosensitivity enhancement in advanced prostate cancer | ||
Adv Sci (Weinh) TWF2 Drives Tumor Progression and Sunitinib Resistance in Renal Cell Carcinoma through Hippo Signaling Suppression |











