• Featured Product
  • KD/KO Validated

LATS1 Monoclonal antibody, PBS Only

LATS1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66569-1-PBS
Clone No.2A8F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

2A8F1, EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66569-1-PBS targets LATS1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11140

Product name: Recombinant human LATS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-135 aa of BC015665

Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI

Predict reactive species
Full Name LATS, large tumor suppressor, homolog 1 (Drosophila)
Calculated Molecular Weight 15 kDa, 127 kDa
Observed Molecular Weight 140-150 kDa, 120 kDa
GenBank Accession NumberBC015665
Gene Symbol LATS1
Gene ID (NCBI) 9113
RRIDAB_2881930
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6PJG3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongds to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).

Loading...
||
New chat Able
正在加载,请稍候...