Tested Applications
| Positive WB detected in | MCF-7 cells, U-87 MG cells |
| Positive IHC detected in | human lung cancer tissue, mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse embryo tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26757-1-AP targets LIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25076 Product name: Recombinant human LIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-202 aa of BC093733 Sequence: ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF Predict reactive species |
| Full Name | leukemia inhibitory factor (cholinergic differentiation factor) |
| Calculated Molecular Weight | 202 aa, 22 kDa |
| Observed Molecular Weight | 22 kDa, 32 kDa |
| GenBank Accession Number | BC093733 |
| Gene Symbol | LIF |
| Gene ID (NCBI) | 3976 |
| RRID | AB_2880624 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15018 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. LIF is a glycoprotein with variable molecular weight (38-67 kDa) due to differential glycosylation. (PMID: 8262236, PMID: 35204717)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LIF antibody 26757-1-AP | Download protocol |
| IHC protocol for LIF antibody 26757-1-AP | Download protocol |
| WB protocol for LIF antibody 26757-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-LIF (Leukemia Inhibitory Factor) antibody (Cat# 26757-1-AP) has been cited in 37 publications across journals including Cell Stem Cell, Cell Reports, Communications Biology, Reproduction Biology and Endocrinology, FASEB Journal, Endocrinology, International Journal of Cancer, Science Reports, Journal of Advanced Research, Human Reproduction, Materials Today Bio, and Toxicology. Research fields associated with these citations predominantly include reproductive biology and endometrial receptivity, oncology spanning lung, breast, pancreatic, esophageal, and ovarian cancers, toxicology, stem cell biology, immunology, and tissue engineering with advanced biomaterials applications.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell LIF signaling regulates outer radial glial to interneuron fate during human cortical development | ||
J Adv Res Synergistic regulation of SLC7A11 and glucose-6-phosphate dehydrogenase in redox homeostasis governs decidualization: a mechanistic insight into adenomyosis-related infertility. | ||
Cell Death Dis Comprehensive secretome profiling and CRISPR screen identifies SFRP1 as a key inhibitor of epidermal progenitor proliferation | ||
Phytomedicine Tanshinone IIA improved psychological stress-induced embryo implantation disorders by inhibiting GC/GR signaling and promoting angiogenesis | ||
Mater Today Bio A sequential and synergistic release sacrificial microgels scaffold for endometrial niche reprogramming and fertility restoration. | ||
Mater Today Bio Microfluidic 3D-printed MSC-laden bioactive hydrogel for intrauterine adhesion prevention and endometrial regeneration. |
