MAP2 Fusion Protein

Catalog number: Ag11349
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Powder

Please visit your regions distributor:


You can also
Request A Quote

Images See all

MAP2 fusion protein Ag11349 SDS-PAGE


Product Name:
human MAP2-6*His fusion protein

Catalog No:
Ag11349

Source:
E. coli-derived, PET28a

Peptide Sequence:
TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL
(213 - 559 aa encoded by BC038857)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Purity:
70%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Back
to top