MEX3C Fusion Protein

Catalog number: Ag18931

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

MEX3C fusion protein Ag18931 SDS-PAGE


Product Name:
human MEX3C-GST fusion protein

Catalog No:
Ag18931

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
GSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVI
(265-415 aa encoded by BC148855)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top