MMP9 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

1

Cat no : Ag0552

Synonyms

CLG4B; GELB; MMP-9



Product Information

Peptide Sequence MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG
(1-100 aa encoded by BC006093)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.

Publications

SpeciesTitle

PLoS One

Osteopontin (OPN) is an important protein to mediate improvements in the biocompatibility of C ion-implanted silicone rubber.

Authors - Shao-liang Wang