MOBP Polyclonal antibody

MOBP Polyclonal Antibody for WB, IHC, ELISA
Cat No. 12472-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

MOBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue
Positive IHC detected inhuman gliomas tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:300-1:600
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12472-1-AP targets MOBP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3156

Product name: Recombinant human MOBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-70 aa of BC022471

Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL

Predict reactive species
Full Name myelin-associated oligodendrocyte basic protein
Calculated Molecular Weight 183 aa, 21 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC022471
Gene Symbol MOBP
Gene ID (NCBI) 4336
RRIDAB_10644161
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13875
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for MOBP antibody 12472-1-APDownload protocol
WB protocol for MOBP antibody 12472-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Neurobiol Dis

Inhibition of CXCR2 enhances CNS remyelination via modulating PDE10A/cAMP signaling pathway

Authors - Cheng Ju
mouseWB

Glia

ST8SIA2 promotes oligodendrocyte differentiation and the integrity of myelin and axons.

Authors - Lukasz Mateusz Szewczyk
humanIHC

Bioengineered

Four specific biomarkers associated with the progression of glioblastoma multiforme in older adults identified using weighted gene co-expression network analysis

Authors - Yushi Yang
Loading...
||
New chat Able
正在加载,请稍候...