Filter: AllWBIHCIF-P

WB analysis using 67654-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 67654-1-Ig (P2RY1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.
IHC staining of mouse brain using 67654-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 67654-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 67654-1-Ig
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 67654-1-Ig
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of rat brain using 67654-1-Ig
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
IF Staining of rat brain using 67654-1-Ig
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
IF Staining of mouse brain using 67654-1-Ig
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
IF Staining of mouse brain using 67654-1-Ig
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

P2RY1 Monoclonal antibody

Name: P2RY1 Monoclonal antibody
Brand: Proteintech
SKU: 67654-1-Ig

P2RY1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67654-1-Ig

Clone No.1A1F3

Publications(4)

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

Synonyms

ADP receptor, ATP receptor, P2Y purinoceptor 1, P2Y1, Purinergic receptor

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite® Plus 647

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue, mouse cerebellum tissue, rabbit brain tissue
Positive IHC detected in	mouse brain tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	rat brain tissue, mouse brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 3 publications below
IHC	See 1 publications below
IF	See 1 publications below

Product Information

67654-1-Ig targets P2RY1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity	human, mouse, rat, pig, rabbit
Cited Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species
Full Name	purinergic receptor P2Y, G-protein coupled, 1
Calculated Molecular Weight	373 aa, 42 kDa
Observed Molecular Weight	55 kDa
GenBank Accession Number	BC074785
Gene Symbol	P2RY1
Gene ID (NCBI)	5028
RRID	AB_2882853
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P47900
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for P2RY1 antibody 67654-1-Ig	Download protocol
WB protocol for P2RY1 antibody 67654-1-Ig	Download protocol
IF protocol for P2RY1 antibody 67654-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	IHC	Sci China Life Sci Inflammatory macrophages exacerbate neutrophil-driven joint damage through ADP/P2Y1 signaling in rheumatoid arthritis. Authors - Xiaoyu Zhang View Article
human	WB	Oncol Lett New prognostic factors and scoring system for patients with acute myeloid leukemia. Authors - Ye Kuang View Article
rat	WB,IF	Neuroscience Purinergic Astrocyte Signaling Driven by TNF-α After Cannabidiol Administration Restores Normal Synaptic Remodeling Following Traumatic Brain Injury Authors - Tenghan Ling View Article
mouse	WB	Nat Commun Astrocytic neuroligin 3 regulates social memory and synaptic plasticity through adenosine signaling in male mice Authors - Rui Dang View Article