Tested Applications
| Positive WB detected in | pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue, mouse cerebellum tissue, rabbit brain tissue |
| Positive IHC detected in | mouse brain tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67654-1-Ig targets P2RY1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species |
| Full Name | purinergic receptor P2Y, G-protein coupled, 1 |
| Calculated Molecular Weight | 373 aa, 42 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC074785 |
| Gene Symbol | P2RY1 |
| Gene ID (NCBI) | 5028 |
| RRID | AB_2882853 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P47900 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
| IHC protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
| WB protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The P2RY1 Monoclonal antibody (1A1F3), catalog number 67654-1-Ig, has 7 total citations. These appear in Nature Communications, Science China Life Sciences, International Immunopharmacology, Neuroscience, Oncology Letters, and bioRxiv. The associated research fields span neuroscience (astrocytic purinergic signaling, synaptic plasticity, traumatic brain injury, gliomagenesis), immunology and inflammation (rheumatoid arthritis), hematology (acute myeloid leukemia), thrombosis/platelet biology, and periodontology linked to type 2 diabetes.
| Species | Application | Title |
|---|---|---|
Nat Commun Astrocytic neuroligin 3 regulates social memory and synaptic plasticity through adenosine signaling in male mice | ||
Sci China Life Sci Inflammatory macrophages exacerbate neutrophil-driven joint damage through ADP/P2Y1 signaling in rheumatoid arthritis. | ||
Int Immunopharmacol Effects of imperatorin on chronic periodontitis associated with type 2 diabetes mellitus | ||
Neuroscience Purinergic Astrocyte Signaling Driven by TNF-α After Cannabidiol Administration Restores Normal Synaptic Remodeling Following Traumatic Brain Injury | ||
Oncol Lett New prognostic factors and scoring system for patients with acute myeloid leukemia. | ||
bioRxiv Sodium/Potassium ATPase Alpha 1 Subunit Fine-tunes Platelet GPCR Signaling Function and is Essential for Thrombosis. |
