Tested Applications
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL647-67654 targets P2RY1 in IF-P applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species |
Full Name | purinergic receptor P2Y, G-protein coupled, 1 |
Calculated Molecular Weight | 373 aa, 42 kDa |
GenBank Accession Number | BC074785 |
Gene Symbol | P2RY1 |
Gene ID (NCBI) | 5028 |
RRID | AB_2920296 |
Conjugate | CoraLite® Plus 647 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P47900 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 647 P2RY1 antibody CL647-67654 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |