Tested Applications
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells, LPS treated RAW 264.7 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 695 publications below |
| IHC | See 141 publications below |
| IF | See 80 publications below |
| ELISA | See 5 publications below |
Product Information
17590-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA, Transwell Assay, Cell treatment applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rabbit, bovine, sheep, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11433 Product name: Recombinant human TNF-a protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species |
| Full Name | tumor necrosis factor (TNF superfamily, member 2) |
| Calculated Molecular Weight | 233 aa, 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC028148 |
| Gene Symbol | TNF-alpha |
| Gene ID (NCBI) | 7124 |
| ENSEMBL Gene ID | ENSG00000232810 |
| RRID | AB_2271853 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01375 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| IHC protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| WB protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Multifunctional hydrogel encapsulated with baicalin for full-layer regeneration of drug-resistant bacteria-infected wounds after radiotherapy | ||
Brain Behav Immun HMGB1 mediates depressive behavior induced by chronic stress through activating the kynurenine pathway. | ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
ACS Cent Sci Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury | ||
Adv Sci (Weinh) 3D Printing of a Vascularized Mini-Liver Based on the Size-Dependent Functional Enhancements of Cell Spheroids for Rescue of Liver Failure | ||
Sci Adv Citrulline regulates macrophage metabolism and inflammation to counter aging in mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (11-15-2025) | The antibody produced clear signals with negligible background and high target specificity.
|
FH Margarita (Verified Customer) (11-22-2023) | Prostate Cancer cell line, overnight incubation, Mouse
![]() |
FH Isha (Verified Customer) (09-20-2021) | signal was very good. My sample was renal tissue lysate after ischemia reperfusion
|












