Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | rat brain tissue, rat cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67268-1-Ig targets TRIM9 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.
| Tested Reactivity | Human, Mouse, Rat, Pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27856 Product name: Recombinant human TRIM9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-350 aa of BC013414 Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR Predict reactive species |
| Full Name | tripartite motif-containing 9 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 90 kDa, 79 kDa, 61 kDa |
| GenBank Accession Number | BC013414 |
| Gene Symbol | TRIM9 |
| Gene ID (NCBI) | 114088 |
| RRID | AB_2882538 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9C026 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRIM9 antibody 67268-1-Ig | Download protocol |
| WB protocol for TRIM9 antibody 67268-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









