TRIM9 Monoclonal antibody, PBS Only

TRIM9 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67268-1-PBS
Clone No.1D2B10

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IHC, Indirect ELISA

KIAA0282, RING finger protein 91, RNF91, SPRING, TRIM9, tripartite motif containing 9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67268-1-PBS targets TRIM9 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27856

Product name: Recombinant human TRIM9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC013414

Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR

Predict reactive species
Full Name tripartite motif-containing 9
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 90 kDa, 79 kDa, 61 kDa
GenBank Accession NumberBC013414
Gene Symbol TRIM9
Gene ID (NCBI) 114088
RRIDAB_2882538
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9C026
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...