Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TXNRD1 Polyclonal antibody

TXNRD1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

TRXR1, EC:1.11.1.2, EC:1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TXNRD1 in ?

Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, Jurkat cells, mouse heart tissue, rat heart tissue
Positive IHC detected inhuman testis tissue, human breast cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:3000-1:10000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11117-1-AP targets TXNRD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1618

Product name: Recombinant human TXNRD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-500 aa of BC018122

Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG

Predict reactive species
Full Name thioredoxin reductase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC018122
Gene Symbol TXNRD1
Gene ID (NCBI) 7296
RRIDAB_2210113
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16881
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)

Protocols

Product Specific Protocols
FC protocol for TXNRD1 antibody 11117-1-APDownload protocol
IF protocol for TXNRD1 antibody 11117-1-APDownload protocol
IHC protocol for TXNRD1 antibody 11117-1-APDownload protocol
WB protocol for TXNRD1 antibody 11117-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-TXNRD1 (Thioredoxin Reductase 1) antibody (Cat# 11117-1-AP) has 89 citations across journals including Nature Cell Biology, Redox Biology, Free Radical Biology and Medicine, Cell Death & Differentiation, Cancer Research, Nucleic Acids Research, Journal of Medicinal Chemistry, European Journal of Medicinal Chemistry, and Scientific Reports. Research fields span ferroptosis, oxidative stress, cancer biology, redox signaling, drug discovery, inflammation, and selenoprotein biology.

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Targeting oncogenic FLT3 uncovers a ferroptosis vulnerability through selenocysteine recoding in acute myeloid leukaemia

Authors - Minhua Li
humanWB

Nat Cell Biol

An mRNA processing pathway suppresses metastasis by governing translational control from the nucleus

Authors - Albertas Navickas
humanWB

Cancer Res

Natural allelic variations in glutathione peroxidase-1 affect it subcellular localization and function.

Authors - Soumen Bera
mouse,HumanWB

Redox Biol

Butaselen prevents hepatocarcinogenesis and progression through inhibiting thioredoxin reductase activity.

Authors - Xiaoqing Zheng
  • KD Validated
humanWB

Redox Biol

Fast regulation of the NF-κB signalling pathway in human skeletal muscle revealed by high-intensity exercise and ischaemia at exhaustion: Role of oxygenation and metabolite accumulation.

Authors - Angel Gallego-Selles
humanWB

Redox Biol

Iron(III)-salophene catalyzes redox cycles that induce phospholipid peroxidation and deplete cancer cells of ferroptosis-protecting cofactors

Authors - Fengting Su
Loading...
||
New chat

Able™

正在加载,请稍候...