Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, Jurkat cells, mouse heart tissue, rat heart tissue |
| Positive IHC detected in | human testis tissue, human breast cancer tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:3000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11117-1-AP targets TXNRD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1618 Product name: Recombinant human TXNRD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 199-500 aa of BC018122 Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG Predict reactive species |
| Full Name | thioredoxin reductase 1 |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC018122 |
| Gene Symbol | TXNRD1 |
| Gene ID (NCBI) | 7296 |
| RRID | AB_2210113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16881 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TXNRD1 antibody 11117-1-AP | Download protocol |
| IF protocol for TXNRD1 antibody 11117-1-AP | Download protocol |
| IHC protocol for TXNRD1 antibody 11117-1-AP | Download protocol |
| WB protocol for TXNRD1 antibody 11117-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-TXNRD1 (Thioredoxin Reductase 1) antibody (Cat# 11117-1-AP) has 89 citations across journals including Nature Cell Biology, Redox Biology, Free Radical Biology and Medicine, Cell Death & Differentiation, Cancer Research, Nucleic Acids Research, Journal of Medicinal Chemistry, European Journal of Medicinal Chemistry, and Scientific Reports. Research fields span ferroptosis, oxidative stress, cancer biology, redox signaling, drug discovery, inflammation, and selenoprotein biology.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Targeting oncogenic FLT3 uncovers a ferroptosis vulnerability through selenocysteine recoding in acute myeloid leukaemia | ||
Nat Cell Biol An mRNA processing pathway suppresses metastasis by governing translational control from the nucleus | ||
Cancer Res Natural allelic variations in glutathione peroxidase-1 affect it subcellular localization and function. | ||
Redox Biol Butaselen prevents hepatocarcinogenesis and progression through inhibiting thioredoxin reductase activity.
| ||
Redox Biol Fast regulation of the NF-κB signalling pathway in human skeletal muscle revealed by high-intensity exercise and ischaemia at exhaustion: Role of oxygenation and metabolite accumulation. | ||
Redox Biol Iron(III)-salophene catalyzes redox cycles that induce phospholipid peroxidation and deplete cancer cells of ferroptosis-protecting cofactors |























