• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated TXNRD1 Polyclonal antibody

TXNRD1 Polyclonal Antibody for FC (Intra)
Cat No. CL647-11117

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

GRIM 12, GRIM12, KDRF, thioredoxin reductase 1, Thioredoxin reductase TR1, TR, TR1, TRXR1, TXNR, TXNRD1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11117 targets TXNRD1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1618

Product name: Recombinant human TXNRD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-500 aa of BC018122

Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG

Predict reactive species
Full Name thioredoxin reductase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC018122
Gene Symbol TXNRD1
Gene ID (NCBI) 7296
RRIDAB_2934846
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16881
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 TXNRD1 antibody CL647-11117Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...