Featured Product
KD/KO Validated

UBC12 Polyclonal antibody

UBC12 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14520-1-AP

Publications(21)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

UBE2M, EC:2.3.2.34, hUbc12, NEDD8 carrier protein, NEDD8 conjugating enzyme Ubc12

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 14520-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14520-1-AP (UBC12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 14520-1-AP
WB result of UBC12 antibody (14520-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBC12 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 14520-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 14520-1-AP (UBC12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of SMMC-7721 using 14520-1-AP
SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14520-1-AP (UBC12 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of L02 using 14520-1-AP
IP result of anti-UBC12 (IP:14520-1-AP, 4ug; Detection:14520-1-AP 1:600) with L02 cells lysate 1800ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat colon using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat lung using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 14520-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14520-1-AP (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of L02 using 14520-1-AP
Immunofluorescent analysis of L02 cells using 14520-1-AP (UBC12 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (21)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, L02 cells, SMMC-7721 cells, HEK-293 cells, Ramos cells
Positive IP detected in	L02 cells
Positive IHC detected in	mouse ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	L02 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14520-1-AP targets UBC12 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, monkey
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5984 Product name: Recombinant human UBC12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-183 aa of BC058924 Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Predict reactive species
Full Name	ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Calculated Molecular Weight	21 kDa
Observed Molecular Weight	21 kDa
GenBank Accession Number	BC058924
Gene Symbol	UBC12
Gene ID (NCBI)	9040
RRID	AB_2878063
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P61081
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for UBC12 antibody 14520-1-AP	Download protocol
IHC protocol for UBC12 antibody 14520-1-AP	Download protocol
IP protocol for UBC12 antibody 14520-1-AP	Download protocol
WB protocol for UBC12 antibody 14520-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB,IF	Nat Commun A potent small-molecule inhibitor of the DCN1-UBC12 interaction that selectively blocks cullin 3 neddylation. Authors - Haibin Zhou View Article
human	IHC	J Exp Clin Cancer Res Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy Authors - Bowen Zheng View Article
mouse,human	WB,IP	Adv Sci (Weinh) Neddylation Targets and Stabilizes NLRP3 to Augment Inflammasome-Mediated Colitis and Mood Disorder. Authors - Wenbin Gai View Article
human	WB	Cancer Biol Med CUL4 E3 ligase regulates the proliferation and apoptosis of lung squamous cell carcinoma and small cell lung carcinoma. Authors - Ting Li View Article
human	IF	Pharmacol Res Orlistat targets NEDD8 conjugating enzyme UBC12 for cancer therapy. Authors - Mengzhen Shen View Article
human, mouse	WB,IF	Cell Death Dis UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence. Authors - Yunhao Chang KO Validated View Article

Reviews

4.0 out of 5

Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Maria (Verified Customer) (02-06-2018)

I tested a free sample of this antibody.No non-specific bands.Load 40ug of protein for a well (15 well comb)I wish I could use a higher dilution of the antibody.