Tested Applications
| Positive WB detected in | K-562 cells, A431 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue, MOLT-4 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12609-1-AP targets WT1 in WB, IHC, IF/ICC, FC (Intra), IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3337 Product name: Recombinant human WT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC032861 Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL Predict reactive species |
| Full Name | Wilms tumor 1 |
| Calculated Molecular Weight | 449 aa, 49 kDa, 57 kDa |
| Observed Molecular Weight | 52-55 kDa |
| GenBank Accession Number | BC032861 |
| Gene Symbol | WT1 |
| Gene ID (NCBI) | 7490 |
| RRID | AB_2216225 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19544 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. WT1 exists some isoforms with the range of molecular weight is 33-50 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for WT1 antibody 12609-1-AP | Download protocol |
| IF protocol for WT1 antibody 12609-1-AP | Download protocol |
| IHC protocol for WT1 antibody 12609-1-AP | Download protocol |
| IP protocol for WT1 antibody 12609-1-AP | Download protocol |
| WB protocol for WT1 antibody 12609-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-WT1 antibody (Cat# 12609-1-AP) has 77 total citations published in journals including Nature Communications, Science Advances, Developmental Cell, Oncogene, Molecular Cell, Cell Death & Disease, Kidney International, Phytomedicine, iScience, PNAS, Theranostics, and Theriogenology. Research fields span renal biology (podocyte injury, diabetic nephropathy), oncology (ovarian cancer, glioma, mesothelioma, leukemia), reproductive biology (Sertoli cells, blood-testis barrier, spermatogenesis), fibrosis, cardiology, and immunology.
| Species | Application | Title |
|---|---|---|
Circulation Aberrant Phase Separation of Endothelial MAML1 Causes Congenital Heart Disease by Suppressing Notch Activity | ||
Kidney Int Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis | ||
Nat Commun EWS-WT1 fusion isoforms establish oncogenic programs and therapeutic vulnerabilities in desmoplastic small round cell tumors | ||
Nat Commun Targeting APLN/APJ restores blood-testis barrier and improves spermatogenesis in murine and human diabetic models | ||
Mol Cell The IMiD target CRBN determines HSP90 activity toward transmembrane proteins essential in multiple myeloma. | ||
J Nanobiotechnology Targeted delivery of TGF-β inhibitor via LHRH-NanoTi reverses the NAT10/ac4C-mediated cisplatin-induced immunosuppressive tumor microenvironment in ovarian cancer. |
Reviews
What customers say
Both reviewers rated the antibody 4 out of 5 stars. One user reported clean signals in IP and Western blot, along with good enrichment in ChIP assays using kidney tissue and podocytes. The other found it performed well for IHC at 1:200 dilution on liver tissues but noted unsatisfactory Western blot results. Overall, users generally find it reliable for IP, IHC, and ChIP applications, with some variability in Western blot performance depending on the sample type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sandrine (Verified Customer) (12-17-2021) | clean signal for IP and western blot. Good relative enrichment for ChIP assays.
|
K (Verified Customer) (12-20-2020) | This Ab worked well for IHC (1:200) but I could't get satisfactory results for western blotting.
|
