WT1 Polyclonal antibody, PBS Only

• 

  WB analysis of K-562 using 12609-1-AP (same clone as 12609-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12609-1-AP (same clone as 12609-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12609-1-AP (same clone as 12609-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 12609-1-AP (same clone as 12609-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 12609-1-AP (same clone as 12609-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 12609-1-AP (same clone as 12609-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12609-1-AP (WT1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 12609-1-AP (same clone as 12609-1-PBS)

  IP result of anti-WT1 (IP:12609-1-AP, 4ug; Detection:12609-1-AP 1:1000) with K-562 cells lysate 1360 ug. This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 12609-1-AP (same clone as 12609-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using WT1 antibody (12609-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 12609-1-AP (same clone as 12609-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human WT1 (12609-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 12609-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WT1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12609-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Wilms tumor 1, Wilms tumor protein

---

Product Information

12609-1-PBS targets WT1 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3337

  Product name: Recombinant human WT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-302 aa of BC032861

  Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL

• Full Name: Wilms tumor 1
• Calculated Molecular Weight: 449 aa, 49 kDa, 57 kDa
• Observed Molecular Weight: 52-55 kDa
• GenBank Accession Number: BC032861
• Gene Symbol: WT1
• Gene ID (NCBI): 7490
• RRID: AB_2216225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. WT1 exists some isoforms with the range of molecular weight is 33-50 kDa.