Tested Applications
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81161-3-RR targets ZAK in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species |
| Full Name | sterile alpha motif and leucine zipper containing kinase AZK |
| Calculated Molecular Weight | 91 kDa |
| GenBank Accession Number | BC001401 |
| Gene Symbol | ZAK |
| Gene ID (NCBI) | 51776 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NYL2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa.







