• Featured Product
  • KD/KO Validated

SLC7A11/xCT Polyclonal antibody

SLC7A11/xCT Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 26864-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

SLC7A11, xCT, Amino acid transport system xc, Amino acid transport system xc-, CCBR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled HeLa cells, HeLa cells, HepG2 cells, unboiled HepG2 cells
Positive IP detected inHeLa cells, A549 cells, HepG2 cells
Positive IHC detected inhuman renal cell carcinoma tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

For optimal WB detection with 26864-1-AP, we do not recommend boiling the sample after lysis.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26864-1-AP targets SLC7A11/xCT in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, chicken, bovine, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25431

Product name: Recombinant human SLC7A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-42 aa of BC012087

Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR

Predict reactive species
Full Name solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC012087
Gene Symbol SLC7A11
Gene ID (NCBI) 23657
RRIDAB_2880661
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UPY5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 26864-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).

Protocols

Product Specific Protocols
IHC protocol for SLC7A11/xCT antibody 26864-1-APDownload protocol
IP protocol for SLC7A11/xCT antibody 26864-1-APDownload protocol
WB protocol for SLC7A11/xCT antibody 26864-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression

Authors - Shiqiao Qiu
WB

Cell Host Microbe

Liberation of daidzein by gut microbial β-galactosidase suppresses acetaminophen-induced hepatotoxicity in mice

Authors - Yunong Zeng
humanWB

Drug Resist Updat

Upregulation of CoQ shifts ferroptosis dependence from GPX4 to FSP1 in acquired radioresistance

Authors - Xu Lin
humanWB

Nat Immunol

Glutathione peroxidase 4-regulated neutrophil ferroptosis induces systemic autoimmunity.

Authors - Pengchong Li
humanWB

ACS Nano

Engineering MMP-2 Activated Nanoparticles Carrying B7-H3 Bispecific Antibodies for Ferroptosis-Enhanced Glioblastoma Immunotherapy

Authors - Rangrang Fan
humanWB

Nat Commun

URI alleviates tyrosine kinase inhibitors-induced ferroptosis by reprogramming lipid metabolism in p53 wild-type liver cancers

Authors - Zhiwen Ding

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vignesh (Verified Customer) (10-03-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: MDA 468 cells
FH

Vignesh (Verified Customer) (09-15-2025)

The results are excellent; bands are clear and loaded 10µg sample.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEPG2A cells
FH

Chloe (Verified Customer) (11-01-2023)

Great antibody works pretty well for a western blot with 1:1000 dilution.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Breast Cancer Cell Lines
SLC7A11/xCT Antibody Western Blot validation (1:1000 dilution) in Breast Cancer Cell Lines (Cat no:26864-1-AP)
FH

James (Verified Customer) (11-18-2022)

Detection of SLC7A11 in liver protein extracts

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Liver
SLC7A11/xCT Antibody Western Blot validation (1/1000 dilution) in Liver (Cat no:26864-1-AP)
FH

Melanie (Verified Customer) (05-11-2022)

Tested the antibody in Hek293T cells. Had to dilute the antibody 1:50000, since the signal was to strong. Very clear gang at the calculated MW. Good antibody!

  • Applications: Western Blot
  • Cell Tissue Type: Hek293T
FH

Amélie (Verified Customer) (05-03-2022)

We used the AB on Bone Marrow derived Macrophages, where Slc7a11 is KO (validate by RT PCR), in Western blot. We did not found a specific staining in the right size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: Bone Marrow derived macrophages from WT or KO mice
SLC7A11/xCT Antibody Western Blot validation (1000 dilution) in Bone Marrow derived macrophages from WT or KO mice (Cat no:26864-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...