XPA Polyclonal antibody

XPA Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA
Cat No. 16462-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

DNA repair protein complementing XP-A cells, Xeroderma pigmentosum group A-complementing protein, XP1, XPAC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HeLa cells, MCF-7 cells
Positive IP detected inL02 cells
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16462-1-AP targets XPA in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9536

Product name: Recombinant human XPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-273 aa of BC014965

Sequence: MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Predict reactive species
Full Name xeroderma pigmentosum, complementation group A
Calculated Molecular Weight374aa,42 kDa; 273aa,31 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC014965
Gene Symbol XPA
Gene ID (NCBI) 7507
RRIDAB_2878261
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23025
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XPA, also named as DNA repair protein complementing XP-A cells, is a 272 amino acid protein, which belongs to the XPA family. XPA is expressed in various cell lines and in skin fibroblasts. XPA is involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. XPA is required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. The calculated molecular weight of XPA is 31 kDa, but modified XPA protein is about 40 kDa (PMID: 17848622).

Protocols

Product Specific Protocols
FC protocol for XPA antibody 16462-1-APDownload protocol
IF protocol for XPA antibody 16462-1-APDownload protocol
IP protocol for XPA antibody 16462-1-APDownload protocol
WB protocol for XPA antibody 16462-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Oncol

PMID: 31249811

Authors - Ma-Sha Huang
humanWB

J Cancer

PMID: 31772670

Authors - Li-Ming Tan
mouseWB

Genes Dev

TRF1 uses a noncanonical function of TFIIH to promote telomere replication

Authors - Zhe Yang
mouse,humanWB,IF

Adv Healthc Mater

Macromolecular NO-Donor Micelles for Targeted and Augmented Chemotherapy against Prostate Cancer

Authors - Jiaxin Chen
humanWB

Front Pharmacol

Triptolide enhances carboplatin-induced apoptosis by inhibiting nucleotide excision repair (NER) activity in melanoma

Authors - Geng Wang
zebrafishIF

Sci Total Environ

AHR-mediated DNA damage contributes to BaP-induced cardiac malformations in zebrafish

Authors - Hongmei Zou
Loading...
||
New chat Able
正在加载,请稍候...