CoraLite® Plus 488-conjugated XPA Polyclonal antibody

XPA Polyclonal Antibody for FC (Intra)
Cat No. CL488-16462

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

XPAC, XP1, Xeroderma pigmentosum group A-complementing protein, DNA repair protein complementing XP-A cells

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16462 targets XPA in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9536

Product name: Recombinant human XPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-273 aa of BC014965

Sequence: MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Predict reactive species
Full Name xeroderma pigmentosum, complementation group A
Calculated Molecular Weight374aa,42 kDa; 273aa,31 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC014965
Gene Symbol XPA
Gene ID (NCBI) 7507
RRIDAB_3083987
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23025
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

XPA, also named as DNA repair protein complementing XP-A cells, is a 272 amino acid protein, which belongs to the XPA family. XPA is expressed in various cell lines and in skin fibroblasts. XPA is involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. XPA is required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. The calculated molecular weight of XPA is 31 kDa, but modified XPA protein is about 40 kDa (PMID: 17848622).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 XPA antibody CL488-16462Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...