TMEM27 Polyclonal antibody

TMEM27 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 19207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

ACE2, CLTRN, Collectrin, NX 17, NX17, TMEM27, transmembrane protein 27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue, mouse kidney tissue
Positive IHC detected inhuman kidney tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19207-1-AP targets TMEM27 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7668

Product name: Recombinant human TMEM27 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-143 aa of BC050606

Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW

Predict reactive species
Full Name transmembrane protein 27
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC050606
Gene Symbol TMEM27
Gene ID (NCBI) 57393
RRIDAB_10860104
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HBJ8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated ins secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).

Protocols

Product Specific Protocols
IF protocol for TMEM27 antibody 19207-1-APDownload protocol
IHC protocol for TMEM27 antibody 19207-1-APDownload protocol
WB protocol for TMEM27 antibody 19207-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...