Tested Applications
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22352-1-AP targets CCL4/MIP-1 beta in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17928 Product name: Recombinant human CCL4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 37-74 aa of BC107433 Sequence: SYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVC Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 4 |
| Calculated Molecular Weight | 92 aa, 10 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC107433 |
| Gene Symbol | CCL4/MIP-1 beta |
| Gene ID (NCBI) | 6351 |
| RRID | AB_3669396 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13236 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CCL4/MIP-1 beta antibody 22352-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

