Tested Applications
| Positive WB detected in | A431 cells, A375 cells, MCF-7 cells, MDA-MB-231 cells, SH-SY5Y cells, SK-N-SH cells |
| Positive IHC detected in | human paracancerous of skin cancer, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24918-1-AP targets ST8SIA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20429 Product name: Recombinant human ST8SIA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 39-136 aa of BC126162 Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK Predict reactive species |
| Full Name | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 |
| Calculated Molecular Weight | 356 aa, 41 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC126162 |
| Gene Symbol | ST8SIA1 |
| Gene ID (NCBI) | 6489 |
| RRID | AB_2879796 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92185 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ST8SIA1 antibody 24918-1-AP | Download protocol |
| WB protocol for ST8SIA1 antibody 24918-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ST8SIA1 Polyclonal antibody (catalog number 24918-1-AP) has 13 citations. These appear in journals including Journal of Advanced Research, Journal of Translational Medicine, NPJ Breast Cancer, Liver International, Frontiers in Pharmacology, Frontiers in Cell and Developmental Biology, Scientific Reports, Annals of Medicine, Molecular Oncology, Frontiers in Physiology, BMC Cancer, Oncology Letters, and bioRxiv. Research fields span cancer biology—melanoma, prostate, renal, breast, cholangiocarcinoma, bladder, and neuroblastoma—plus vascular smooth muscle, dental pulp, and learning/memory studies.
| Species | Application | Title |
|---|---|---|
J Adv Res SA supplementation during lactation promotes learning and memory by reducing H3K27me3 levels | ||
J Transl Med GD3s-mediated lipid metabolism reprograming promotes proliferation and metastasis of melanoma. | ||
NPJ Breast Cancer Targeting GD2 with naxitamab overcomes GD3 synthase-driven immune suppression in triple-negative breast cancer. | ||
Liver Int Ganglioside GD2 Contributes to a Stem-Like Phenotype in Intrahepatic Cholangiocarcinoma | ||
Front Pharmacol Identifying an Immune-Related Gene ST8SIA1 as a Novel Target in Patients With Clear-Cell Renal Cell Carcinoma. | ||
Front Cell Dev Biol PRC2-dependent regulation of ganglioside expression during dedifferentiation contributes to the proliferation and migration of vascular smooth muscle cells |
