Tested Applications
| Positive WB detected in | A431 cells, A375 cells, MCF-7 cells, MDA-MB-231 cells, SH-SY5Y cells, SK-N-SH cells |
| Positive IHC detected in | human paracancerous of skin cancer, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
24918-1-AP targets ST8SIA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20429 Product name: Recombinant human ST8SIA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 39-136 aa of BC126162 Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK Predict reactive species |
| Full Name | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 |
| Calculated Molecular Weight | 356 aa, 41 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC126162 |
| Gene Symbol | ST8SIA1 |
| Gene ID (NCBI) | 6489 |
| RRID | AB_2879796 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92185 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ST8SIA1 antibody 24918-1-AP | Download protocol |
| WB protocol for ST8SIA1 antibody 24918-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Oncol Upregulation of cell surface GD3 ganglioside phenotype is associated with human melanoma brain metastasis. | ||
Front Pharmacol Identifying an Immune-Related Gene ST8SIA1 as a Novel Target in Patients With Clear-Cell Renal Cell Carcinoma. | ||
Oncol Lett ST8SIA1 inhibits the proliferation, migration and invasion of bladder cancer cells by blocking the JAK/STAT signaling pathway. | ||
bioRxiv Role of GD2 and its biosynthetic enzyme GD3 synthase in prostate cancer tumorigenesis
| ||
Front Cell Dev Biol PRC2-dependent regulation of ganglioside expression during dedifferentiation contributes to the proliferation and migration of vascular smooth muscle cells | ||
Liver Int Ganglioside GD2 Contributes to a Stem-Like Phenotype in Intrahepatic Cholangiocarcinoma |











