Filter: AllWBIHC

WB analysis using 24918-1-AP (same clone as 24918-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 24918-1-AP (ST8SIA1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24918-1-PBS in a different storage buffer formulation.
WB analysis using 24918-1-AP (same clone as 24918-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 24918-1-AP (ST8SIA1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24918-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 24918-1-AP (same clone as 24918-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24918-1-AP (ST8SIA1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24918-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 24918-1-AP (same clone as 24918-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24918-1-AP (ST8SIA1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24918-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 24918-1-AP (same clone as 24918-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24918-1-AP (ST8SIA1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24918-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

ST8SIA1 Polyclonal antibody, PBS Only

ST8SIA1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24918-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Alpha-2,8-sialyltransferase 8A, Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, EC:2.4.3.8, Sialyltransferase St8Sia I, SIAT8

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24918-1-PBS targets ST8SIA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20429 Product name: Recombinant human ST8SIA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 39-136 aa of BC126162 Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK Predict reactive species
Full Name	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Calculated Molecular Weight	356 aa, 41 kDa
Observed Molecular Weight	43 kDa
GenBank Accession Number	BC126162
Gene Symbol	ST8SIA1
Gene ID (NCBI)	6489
RRID	AB_2879796
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92185
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775)