Tested Applications
| Positive WB detected in | mouse colon tissue, rat colon tissue |
| Positive IHC detected in | rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26696-1-AP targets BMPR1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species |
| Full Name | bone morphogenetic protein receptor, type IB |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC047773 |
| Gene Symbol | BMPR1B |
| Gene ID (NCBI) | 658 |
| RRID | AB_3085892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00238 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BMPR1B (Bone morphogenetic protein receptor type-1B) is also named as CDw293. BMPR1B belongs to the protein kinase superfamily. BMPR1B is on ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. BMPR1B is receptor for BMP7/OP-1 and GDF5. BMPR1B Positively regulates chondrocyte differentiation through GDF5 interaction.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BMPR1B antibody 26696-1-AP | Download protocol |
| WB protocol for BMPR1B antibody 26696-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







