Filter: AllWBIHCIF/ICC

WB analysis using 29041-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 29041-1-AP (CES1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
WB analysis using 29041-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 29041-1-AP (CES1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
IHC staining of mouse liver using 29041-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29041-1-AP (CES1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of C2C12 using 29041-1-AP
Immunofluorescent analysis of (-20°C Methanol) fixed C2C12 cells using CES1 antibody (29041-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).
IF Staining of HepG2 using 29041-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CES1 antibody (29041-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).
IF Staining of C2C12 using 29041-1-AP
Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using CES1 antibody (29041-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

CES1 Polyclonal antibody

Name: CES1 Polyclonal antibody
Brand: Proteintech
SKU: 29041-1-AP

CES1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29041-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ACAT, Brain carboxylesterase hBr1, CEH, CES1, CES2, Cocaine carboxylesterase, Egasyn, HMSE, HMSE1, Liver carboxylesterase 1, PCE 1, REH, Retinyl ester hydrolase, Serine esterase 1, SES1, TGH, Triacylglycerol hydrolase

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	THP-1 cells, rat liver tissue, hepG2 cells, Caco-2 cells
Positive IHC detected in	mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	C2C12 cells, HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29041-1-AP targets CES1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.

Tested Reactivity	Human, rat, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30534 Product name: Recombinant human CES1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 505-566 aa of BC012418 Sequence: NGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL Predict reactive species
Full Name	carboxylesterase 1 (monocyte/macrophage serine esterase 1)
Calculated Molecular Weight	566 aa, 62 kDa
Observed Molecular Weight	62 kDa
GenBank Accession Number	BC012418
Gene Symbol	CES1
Gene ID (NCBI)	1066
RRID	AB_3086096
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P23141
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human carboxylesterase 1 (hCE1 or CES1) is a serine esterase that hydrolyzes a variety of endogenous and exogenous substrates. CES1 contributes to approximately 90% of hepatic hydrolytic activity in human livers (PMID: 27895113). Variation in CES1 has the ability to affect the metabolism of methylphenidate (PMID: 28087982). CES1 has 567 amino acids and a theoretical molecular mass of 62 kDa.

Protocols

Product Specific Protocols
IF protocol for CES1 antibody 29041-1-AP	Download protocol
IHC protocol for CES1 antibody 29041-1-AP	Download protocol
WB protocol for CES1 antibody 29041-1-AP	Download protocol