Tested Applications
| Positive WB detected in | K-562 cells, nouse brain tissue, mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
29474-1-AP targets WEE1 in WB, IF, CoIP, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30194 Product name: Recombinant human WEE1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 515-646 aa of BC051831 Sequence: PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY Predict reactive species |
| Full Name | WEE1 homolog (S. pombe) |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 72 kDa,110 kDa |
| GenBank Accession Number | BC051831 |
| Gene Symbol | WEE1 |
| Gene ID (NCBI) | 7465 |
| RRID | AB_2918314 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30291 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WEE1 kinase is a serine-threonine kinase that regulates G2/M checkpoint transition. WEE1 triggers G2/M arrest through inhibitory phosphorylation on Tyr15 of CDK1 (Cdc2) and preventing entry into mitosis to allow DNA repair during DNA damage (PMID: 27427153).The predicted native molecular weight for Wee1 based on the intact human Wee1 cDNA sequence is 72 kDa, whereas the 95-110 kDa protein is a highly modified product (PMID: 7568188). Others have shown that Wee1 is 70-72 kDa and 49-55 kDa (PMID: 12214061).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for WEE1 antibody 29474-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res DIS3L2 ribonuclease degrades terminal-uridylated RNA to ensure oocyte maturation and female fertility | ||
J Cell Mol Med Venetoclax enhances DNA damage induced by XPO1 inhibitors: A novel mechanism underlying the synergistic antileukaemic effect in acute myeloid leukaemia. | ||
Oncol Res SORBS1 Knockdown Resists S/G2 Arrest and Apoptosis Caused by Polyphyllin H-Induced DNA Damage in Pancreatic Cancer | ||
Reprod Toxicol High-dose zearalenone exposure disturbs G2/M transition during mouse oocyte maturation. | ||
Anal Cell Pathol (Amst) miR-138-5p Inhibits the Growth and Invasion of Glioma Cells by Regulating WEE1. | ||
J Pharm Pharmacol GL-V9 synergizes with oxaliplatin of colorectal cancer via Wee1 degradation mediated by HSP90 inhibition |

