Tested Applications
| Positive WB detected in | 37°C incubated mouse kidney tissue, mouse kidney tissue, mouse liver tissue, mouse liver tissue (37℃ incubated), rat liver tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lung cancer tissue |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30031-1-AP targets SLC43A2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31341 Product name: Recombinant human SLC43A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 516-569 aa of BC027923 Sequence: WVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKINGSSNQEAFV Predict reactive species |
| Full Name | solute carrier family 43, member 2 |
| Calculated Molecular Weight | 63 kDa |
| Observed Molecular Weight | 48-53 kDa |
| GenBank Accession Number | BC027923 |
| Gene Symbol | SLC43A2 |
| Gene ID (NCBI) | 124935 |
| RRID | AB_3086213 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N370 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC43A2 (solute carrier family 43 member 2, also known as LAT4) is a multi-pass transmembrane protein that mediates sodium- and chloride-independent uptake of large neutral amino acids, including methionine, leucine and phenylalanine. Highly expressed in kidney, placenta and liver, it supplies essential amino acids to support fetal growth, protein synthesis and one-carbon metabolism. Over-expressed in head-and-neck, liver and other cancers, SLC43A2-driven methionine influx maintains methylation reactions and YAP activity, promoting tumor proliferation and chemo-resistance . Pharmacological inhibition of SLC43A2 sensitizes tumors to therapy, highlighting its potential as a metabolic target. (PMID: 39747898; 15659399; 30379325)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC43A2 antibody 30031-1-AP | Download protocol |
| IHC protocol for SLC43A2 antibody 30031-1-AP | Download protocol |
| WB protocol for SLC43A2 antibody 30031-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











