Filter: AllWBIHCIF-PFC (Intra)

WB analysis using 30031-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis using 30031-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human placenta using 30031-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 30031-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human lung cancer using 30031-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using SLC43A2 antibody (30031-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
FC experiment of Jurkat using 30031-1-AP
1x10^6 Jurkat cells were intracellularly stained with 0.25 ug SLC43A2 Polyclonal antibody (30031-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017).

SLC43A2 Polyclonal antibody

Name: SLC43A2 Polyclonal antibody
Brand: Proteintech
SKU: 30031-1-AP

SLC43A2 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 30031-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

LAT4, L-type amino acid transporter 4, PP7664

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	37°C incubated mouse kidney tissue, mouse kidney tissue, mouse liver tissue, mouse liver tissue (37℃ incubated), rat liver tissue
Positive IHC detected in	human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human lung cancer tissue
Positive FC (Intra) detected in	Jurkat cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30031-1-AP targets SLC43A2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag31341 Product name: Recombinant human SLC43A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 516-569 aa of BC027923 Sequence: WVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKINGSSNQEAFV Predict reactive species
Full Name	solute carrier family 43, member 2
Calculated Molecular Weight	63 kDa
Observed Molecular Weight	48-53 kDa
GenBank Accession Number	BC027923
Gene Symbol	SLC43A2
Gene ID (NCBI)	124935
RRID	AB_3086213
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8N370
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC43A2 (solute carrier family 43 member 2, also known as LAT4) is a multi-pass transmembrane protein that mediates sodium- and chloride-independent uptake of large neutral amino acids, including methionine, leucine and phenylalanine. Highly expressed in kidney, placenta and liver, it supplies essential amino acids to support fetal growth, protein synthesis and one-carbon metabolism. Over-expressed in head-and-neck, liver and other cancers, SLC43A2-driven methionine influx maintains methylation reactions and YAP activity, promoting tumor proliferation and chemo-resistance . Pharmacological inhibition of SLC43A2 sensitizes tumors to therapy, highlighting its potential as a metabolic target. (PMID: 39747898; 15659399; 30379325)

Protocols

Product Specific Protocols
IF protocol for SLC43A2 antibody 30031-1-AP	Download protocol
IHC protocol for SLC43A2 antibody 30031-1-AP	Download protocol
WB protocol for SLC43A2 antibody 30031-1-AP	Download protocol