SLC43A2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30031-1-AP (same clone as 30031-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30031-1-AP (same clone as 30031-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 30031-1-AP (same clone as 30031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 30031-1-AP (same clone as 30031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30031-1-AP (SLC43A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human lung cancer using 30031-1-AP (same clone as 30031-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using SLC43A2 antibody (30031-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 30031-1-AP (same clone as 30031-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug SLC43A2 Polyclonal antibody (30031-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017). This data was developed using the same antibody clone with 30031-1-PBS in a different storage buffer formulation.

SLC43A2 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 30031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

LAT4, L-type amino acid transporter 4, PP7664

---

Product Information

30031-1-PBS targets SLC43A2 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31341

  Product name: Recombinant human SLC43A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 516-569 aa of BC027923

  Sequence: WVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKINGSSNQEAFV

• Full Name: solute carrier family 43, member 2
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 48-53 kDa
• GenBank Accession Number: BC027923
• Gene Symbol: SLC43A2
• Gene ID (NCBI): 124935
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N370
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC43A2 (solute carrier family 43 member 2, also known as LAT4) is a multi-pass transmembrane protein that mediates sodium- and chloride-independent uptake of large neutral amino acids, including methionine, leucine and phenylalanine. Highly expressed in kidney, placenta and liver, it supplies essential amino acids to support fetal growth, protein synthesis and one-carbon metabolism. Over-expressed in head-and-neck, liver and other cancers, SLC43A2-driven methionine influx maintains methylation reactions and YAP activity, promoting tumor proliferation and chemo-resistance . Pharmacological inhibition of SLC43A2 sensitizes tumors to therapy, highlighting its potential as a metabolic target. (PMID: 39747898; 15659399; 30379325)