Product Information
60236-1-PBS targets PAX7 as part of a matched antibody pair:
MP51040-1: 60236-2-PBS capture and 60236-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19171 Product name: Recombinant human PAX7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 463-518 aa of BC121165 Sequence: YGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT Predict reactive species |
Full Name | paired box 7 |
Calculated Molecular Weight | 520 aa, 57 kDa |
GenBank Accession Number | BC121165 |
Gene Symbol | PAX7 |
Gene ID (NCBI) | 5081 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P23759 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
PAX7 belongs to the paired box protein family of transcription factors. It is an important regulator of neural and skeletal muscle development. Recent research indicates an essential function of Pax7 for renewal and maintenance of muscle stem cells. A chromosomal aberration involving PAX7 is a cause of rhabdomyosarcoma 2 (RMS2) which also known as alveolar rhabdomyosarcoma.