PAX7 Monoclonal antibody, PBS Only (Detector)

PAX7 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60236-1-PBS
Clone No.2D3D1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

2D3D1, paired box 7, Paired box protein Pax-7, PAX 7, PAX-7

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60236-1-PBS targets PAX7 as part of a matched antibody pair:

MP51040-1: 60236-2-PBS capture and 60236-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19171

Product name: Recombinant human PAX7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 463-518 aa of BC121165

Sequence: YGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Predict reactive species
Full Name paired box 7
Calculated Molecular Weight 520 aa, 57 kDa
GenBank Accession NumberBC121165
Gene Symbol PAX7
Gene ID (NCBI) 5081
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP23759
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PAX7 belongs to the paired box protein family of transcription factors. It is an important regulator of neural and skeletal muscle development. Recent research indicates an essential function of Pax7 for renewal and maintenance of muscle stem cells. A chromosomal aberration involving PAX7 is a cause of rhabdomyosarcoma 2 (RMS2) which also known as alveolar rhabdomyosarcoma.

Loading...
||
New chat Able
正在加载,请稍候...