Product Information
60260-3-PBS targets Mammaglobin A as part of a matched antibody pair:
MP51209-2: 60260-2-PBS capture and 60260-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20122 Product name: Recombinant human SCGB2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC067220 Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG Predict reactive species |
| Full Name | secretoglobin, family 2A, member 2 |
| Calculated Molecular Weight | 120 aa, 13 kDa |
| GenBank Accession Number | BC067220 |
| Gene Symbol | Mammaglobin A |
| Gene ID (NCBI) | 4250 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13296 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

