Product Information
60434-2-PBS targets ATP5L as part of a matched antibody pair:
MP50581-1: 60434-1-PBS capture and 60434-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9287 Product name: Recombinant human ATP5L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015128 Sequence: MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIANSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV Predict reactive species |
| Full Name | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC015128 |
| Gene Symbol | ATP5L |
| Gene ID (NCBI) | 10632 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O75964 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



