Product Information
60594-4-PBS targets CACNA1A as part of a matched antibody pair:
MP50845-2: 60594-3-PBS capture and 60594-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33902 Product name: Recombinant human CACNA1A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 821-920 aa of NM_000068 Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE Predict reactive species |
| Full Name | calcium channel, voltage-dependent, P/Q type, alpha 1A subunit |
| Calculated Molecular Weight | 282 kDa |
| GenBank Accession Number | NM_000068 |
| Gene Symbol | CACNA1A |
| Gene ID (NCBI) | 773 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00555 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
