Product Information
60756-5-PBS targets NUCB2 as part of a matched antibody pair:
MP51204-3: 60756-1-PBS capture and 60756-5-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag34234 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
Full Name | nucleobindin 2 |
Calculated Molecular Weight | 50 kDa |
GenBank Accession Number | NM_005013 |
Gene Symbol | NUCB2 |
Gene ID (NCBI) | 4925 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | P80303 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |