Product Information
60776-3-PBS targets VHL as part of a matched antibody pair:
MP51106-2: 60777-1-PBS capture and 60776-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag28860 Product name: Recombinant human VHL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 90-172 aa of BC058831 Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species | 
                                    
| Full Name | von Hippel-Lindau tumor suppressor | 
| Calculated Molecular Weight | 172 aa, 20 kDa | 
| GenBank Accession Number | BC058831 | 
| Gene Symbol | VHL | 
| Gene ID (NCBI) | 7428 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P40337 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 



