Product Information
60876-5-PBS targets SLC10A1 as part of a matched antibody pair:
MP51290-4: 60876-5-PBS capture and 60876-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25680 Product name: Recombinant human SLC10A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 136-219 aa of BC074724 Sequence: LLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMT Predict reactive species |
Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 1 |
Calculated Molecular Weight | 349 aa, 38 kDa |
GenBank Accession Number | BC074724 |
Gene Symbol | SLC10A1 |
Gene ID (NCBI) | 6554 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | Q14973 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |