Product Information
61073-1-PBS targets AQP5 as part of a matched antibody pair:
MP51667-1: 61073-1-PBS capture and 61073-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14514 Product name: Recombinant human AQP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species |
| Full Name | aquaporin 5 |
| Calculated Molecular Weight | 265 aa, 28 kDa |
| GenBank Accession Number | BC032946 |
| Gene Symbol | AQP5 |
| Gene ID (NCBI) | 362 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | P55064 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



