Tested Applications
| Positive WB detected in | THP-1 cells, Jurkat cells, U-937 cells, HL-60 cells, Raji cells |
| Positive IHC detected in | human tonsillitis tissue, human cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:10000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
66054-1-Ig targets ARHGDIB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9091 Product name: Recombinant human ARHGDIB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-201 aa of BC009200 Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Predict reactive species |
| Full Name | Rho GDP dissociation inhibitor (GDI) beta |
| Calculated Molecular Weight | 201 aa, 23 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC009200 |
| Gene Symbol | ARHGDIB |
| Gene ID (NCBI) | 397 |
| RRID | AB_11045657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P52566 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ARHGDIB antibody 66054-1-Ig | Download protocol |
| IHC protocol for ARHGDIB antibody 66054-1-Ig | Download protocol |
| WB protocol for ARHGDIB antibody 66054-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













