ARHGDIB Monoclonal antibody, PBS Only

ARHGDIB Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66054-1-PBS
Clone No.3E7B7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

3E7B7, GDIA2, GDID4, Ly GDI, Ly-GDI

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66054-1-PBS targets ARHGDIB in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9091

Product name: Recombinant human ARHGDIB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-201 aa of BC009200

Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE

Predict reactive species
Full Name Rho GDP dissociation inhibitor (GDI) beta
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC009200
Gene Symbol ARHGDIB
Gene ID (NCBI) 397
RRIDAB_11045657
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP52566
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer.

Loading...
||
New chat Able
正在加载,请稍候...