Tested Applications
Positive WB detected in | pig heart tissue, pig skeletal muscle tissue, rat heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
66415-1-Ig targets AGTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species |
Full Name | angiotensin II receptor, type 1 |
Calculated Molecular Weight | 359 aa, 41 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC022447 |
Gene Symbol | AGTR1 |
Gene ID (NCBI) | 185 |
RRID | AB_2881787 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P30556 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AGTR1 antibody 66415-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Adv Res Vitamin D/VDR regulates peripheral energy homeostasis via central renin-angiotensin system. | ||
Int J Biol Macromol A novel angiotensin I-converting enzyme inhibitory peptide APPLRP from Grifola frondosa ameliorated the Ang II-induced vascular modeling in zebrafish model by mediating smooth muscle cells |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Anca (Verified Customer) (10-30-2019) | We could detect AT1R from Plazenta, but only by using Chemiluminiscence. Unfortunately, the pozitive control that we used didn't worked.
|