AGTR1 Monoclonal antibody, PBS Only

AGTR1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66415-1-PBS
Clone No.2C5G11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Angiotensin II type-1 receptor, Angiotensin II type 1 receptor, AGTR1B, AGTR1A, AG2S

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66415-1-PBS targets AGTR1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14461

Product name: Recombinant human AGTR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 290-359 aa of BC022447

Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE

Predict reactive species
Full Name angiotensin II receptor, type 1
Calculated Molecular Weight 359 aa, 41 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC022447
Gene Symbol AGTR1
Gene ID (NCBI) 185
RRIDAB_2881787
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30556
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580).

Loading...
||
New chat Able
正在加载,请稍候...