AGTR1 Monoclonal antibody, PBS Only

• 

  WB analysis of pig heart using 66415-1-Ig (same clone as 66415-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66415-1-Ig (AGTR1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66415-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 66415-1-Ig (same clone as 66415-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66415-1-Ig (AGTR1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66415-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig skeletal muscle using 66415-1-Ig (same clone as 66415-1-PBS)

  pig skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66415-1-Ig (AGTR1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66415-1-PBS in a different storage buffer formulation.

AGTR1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66415-1-PBS

Clone No.2C5G11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

Angiotensin II type-1 receptor, Angiotensin II type 1 receptor, AGTR1B, AGTR1A, AG2S

---

Product Information

66415-1-PBS targets AGTR1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14461

  Product name: Recombinant human AGTR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 290-359 aa of BC022447

  Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE

• Full Name: angiotensin II receptor, type 1
• Calculated Molecular Weight: 359 aa, 41 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC022447
• Gene Symbol: AGTR1
• Gene ID (NCBI): 185
• RRID: AB_2881787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30556
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580).