Product Information
66561-3-PBS targets SMARCA4/BRG1 as part of a matched antibody pair:
MP51084-1: 66561-2-PBS capture and 66561-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
Calculated Molecular Weight | 1647 aa, 185 kDa |
GenBank Accession Number | BC150298 |
Gene Symbol | SMARCA4 |
Gene ID (NCBI) | 6597 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P51532 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |