Product Information
66926-3-PBS targets GPNMB as part of a matched antibody pair:
MP50045-2: 66926-2-PBS capture and 66926-3-PBS detection (validated in Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Affinity | KD=3.05 x 10-10M KOff=2.25 x 10-6M KOn=7.38 x 103M |
Immunogen |
CatNo: Ag26747 Product name: Recombinant human GPNMB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 38-158 aa of BC011595 Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD Predict reactive species |
Full Name | glycoprotein (transmembrane) nmb |
Calculated Molecular Weight | 64 kDa |
GenBank Accession Number | BC011595 |
Gene Symbol | GPNMB |
Gene ID (NCBI) | 10457 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q14956 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |